Full Product Name
Anti-KCNH1 Picoband antibody
Product Synonym Names
Potassium voltage-gated channel subfamily H member 1; Ether-a-go-go potassium channel 1
Product Gene Name
anti-KCNH1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for O95259
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Immunogen
A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
Subcellular Localization
Cell membrane.
Tissue Specificity
Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-KCNH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-KCNH1 antibody
Description: Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.
Protein Function: Pore-forming (alpha) subunit of a voltage-gated delayed rectifier potassium channel (PubMed: 9738473, PubMed: 11943152, PubMed: 10880439, PubMed: 22732247, PubMed: 25556795, PubMed: 27325704, PubMed: 27005320, PubMed: 27618660). Channel properties are modulated by subunit assembly (PubMed: 11943152). Mediates IK(NI) current in myoblasts (PubMed: 9738473). Involved in the regulation of cell proliferation and differentiation, in particular adipogenic and osteogenic differentiation in bone marrow-derived mesenchymal stem cells (MSCs) (PubMed: 23881642).
Applications Tested/Suitable for anti-KCNH1 antibody
Western Blot (WB)
Application Notes for anti-KCNH1 antibody
WB: 0.1-0.5mug/ml
Western Blot (WB) of anti-KCNH1 antibody
Figure 1. Western blot analysis of KCNH1 using anti-KCNH1 antibody (MBS1750552).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human COLO-320 cell lysate,
Lane 2: human HepG2 cell lysate,
Lane 3: human A549 cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-KCNH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for KCNH1 at approximately 150KD. The expected band size for KCNH1 is at 111KD.

NCBI/Uniprot data below describe general gene information for KCNH1. It may not necessarily be applicable to this product.
NCBI Accession #
NP_002229.1
[Other Products]
NCBI GenBank Nucleotide #
NM_002238.3
[Other Products]
UniProt Primary Accession #
O95259
[Other Products]
UniProt Secondary Accession #
O76035; Q14CL3; B1AQ26[Other Products]
UniProt Related Accession #
O95259[Other Products]
Molecular Weight
108,597 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily H member 1 isoform 2
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily H member 1
NCBI Official Symbol
KCNH1??[Similar Products]
NCBI Official Synonym Symbols
EAG; EAG1; ZLS1; TMBTS; h-eag; hEAG1; Kv10.1
??[Similar Products]
NCBI Protein Information
potassium voltage-gated channel subfamily H member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily H member 1
UniProt Synonym Protein Names
Ether-a-go-go potassium channel 1
Protein Family
Potassium voltage-gated channel subfamily
UniProt Gene Name
KCNH1??[Similar Products]
UniProt Synonym Gene Names
; h-eag; hEAG1??[Similar Products]
NCBI Summary for KCNH1
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
UniProt Comments for KCNH1
Pore-forming (alpha) subunit of a voltage-gated delayed rectifier potassium channel (PubMed:9738473, PubMed:11943152, PubMed:10880439, PubMed:22732247, PubMed:25556795, PubMed:27325704, PubMed:27005320, PubMed:27618660). Channel properties are modulated by subunit assembly (PubMed:11943152). Mediates IK(NI) current in myoblasts (PubMed:9738473). Involved in the regulation of cell proliferation and differentiation, in particular adipogenic and osteogenic differentiation in bone marrow-derived mesenchymal stem cells (MSCs) (PubMed:23881642).
Research Articles on KCNH1
1. in this report, we present two independent screening campaigns in which we wanted to identify small molecules that bind to either the intracellular cytoplasmic amino terminal Per-Arnt-Sim (PAS) domain from the human EAG-related gene (ERG) channel or the amino or carboxy terminal globular domains from the mouse EAG1 channel, affecting their interaction.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.