Product Name
Cofilin 2 (CFL2), Polyclonal Antibody
Full Product Name
Anti-Cofilin 2 Antibody
Product Synonym Names
CFL 2; CFL2; CFL-2; Cofilin 2 muscle; Cofilin; Cofilin muscle; Cofilin2; Cofilin 2; Cofilin-2; NEM 7; NEM7; Q9Y281; Cofilin-2; cofilin 2
Product Gene Name
anti-CFL2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q9Y281
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-CFL2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CFL2 antibody
Rabbit IgG polyclonal antibody for Cofilin-2 (CFL2) detection.
Background: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Applications Tested/Suitable for anti-CFL2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-CFL2 antibody
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat
Immunohistochemisry Paraffin: 0.5-1mug/ml; Tested Species: Human, Mouse, Rat
Tested Species:In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Western Blot (WB) of anti-CFL2 antibody
Western blot analysis of Cofilin 2 expression in rat liver extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Cofilin 24 at 19KD was detected using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

Immunohistochemistry (IHC) of anti-CFL2 antibody
Cofilin 2 was detected in paraffin-embedded sections of mouse cardiac muscle tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-CFL2 antibody
Cofilin 2 was detected in paraffin-embedded sections of rat skeletal muscle tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-CFL2 antibody
Cofilin 2 was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.

NCBI/Uniprot data below describe general gene information for CFL2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001230574.1
[Other Products]
NCBI GenBank Nucleotide #
NM_001243645.1
[Other Products]
UniProt Primary Accession #
Q9Y281
[Other Products]
UniProt Secondary Accession #
G3V5P4[Other Products]
UniProt Related Accession #
Q9Y281[Other Products]
NCBI Official Full Name
cofilin-2 isoform 2
NCBI Official Synonym Full Names
cofilin 2
NCBI Official Symbol
CFL2??[Similar Products]
NCBI Official Synonym Symbols
NEM7
??[Similar Products]
NCBI Protein Information
cofilin-2
UniProt Protein Name
Cofilin-2
UniProt Synonym Protein Names
Cofilin, muscle isoform
UniProt Gene Name
CFL2??[Similar Products]
UniProt Entry Name
COF2_HUMAN
NCBI Summary for CFL2
This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
UniProt Comments for CFL2
Cofilin-2: a cytoskeletal protein that controls actin depolymerization. Has a 5-10-fold higher affinity for ATP-actin monomers than cofilin-1. May promote filament assembly rather than disassembly. Two alternatively spliced variants are described. Isoform b is expressed predominantly in skeletal muscle and heart, while isoform a is expressed in various tissues.
Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Cytoskeletal
Chromosomal Location of Human Ortholog: 14q12
Cellular Component: extracellular space; I band
Molecular Function: protein binding
Biological Process: positive regulation of actin filament depolymerization
Disease: Nemaline Myopathy 7
Product References and Citations for anti-CFL2 antibody
1. "Entrez Gene: CFL2 cofilin 2 (muscle)".
2. Agrawal PB, Greenleaf RS, Tomczak KK, Lehtokari VL, Wallgren-Pettersson C, Wallefeld W, Laing NG, Darras BT, Maciver SK, Dormitzer PR, Beggs AH (January 2007). "Nemaline myopathy with minicores caused by mutation of the CFL2 gene encoding the skeletal muscle actin-binding protein, cofilin-2". Am. J. Hum. Genet. 80 (1): 162-7.
3. Gillett GT, Fox MF, Rowe PS, Casimir CM, Povey S (May 1996). "Mapping of human non-muscle type cofilin (CFL1) to chromosome 11q13 and muscle-type cofilin (CFL2) to chromosome 14". Ann. Hum. Genet. 60 (Pt 3): 201-11.
Research Articles on CFL2
1. The serum lever of Alzheimer's disease were increase and the expression of clf2 strongly correlated with the Mini-Mental State Examination scores of the AD patients
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.