Full Product Name
MFRP antibody
Product Synonym Names
Polyclonal MFRP; Anti-MFRP; FLJ30570; NNO2; rd6; Membrane Frizzled-Related Protein
Product Gene Name
anti-MFRP antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Specificity
MFRP antibody was raised against the N terminal of MFRP
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFRP antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.
Immunogen
MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids ?TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-MFRP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-MFRP antibody
Rabbit polyclonal MFRP antibody raised against the N terminal of MFRP
Product Categories/Family for anti-MFRP antibody
Signal Transduction; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-MFRP antibody
Western Blot (WB)
Application Notes for anti-MFRP antibody
WB: 1 ug/ml
Western Blot (WB) of anti-MFRP antibody
MFRP antibody (MBS839542) used at 1 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for MFRP. It may not necessarily be applicable to this product.
NCBI Accession #
NP_113621.1
[Other Products]
NCBI GenBank Nucleotide #
NM_031433.3
[Other Products]
UniProt Secondary Accession #
Q335M3; Q96DQ9; B0YJ36; B0YJ37; B4DHN8[Other Products]
UniProt Related Accession #
Q9BY79[Other Products]
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
membrane frizzled-related protein
NCBI Official Synonym Full Names
membrane frizzled-related protein
NCBI Official Symbol
MFRP??[Similar Products]
NCBI Official Synonym Symbols
RD6; NNO2; MCOP5
??[Similar Products]
NCBI Protein Information
membrane frizzled-related protein
UniProt Protein Name
Membrane frizzled-related protein
UniProt Synonym Protein Names
Membrane-type frizzled-related protein
Protein Family
Membrane frizzled-related protein
UniProt Gene Name
MFRP??[Similar Products]
UniProt Entry Name
MFRP_HUMAN
NCBI Summary for MFRP
This gene encodes a member of the frizzled-related protein family. The encoded protein plays an important role in eye development and mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic transcript which also encodes C1q and tumor necrosis factor related protein 5 (C1QTNF5). [provided by RefSeq, Jun 2013]
UniProt Comments for MFRP
MFRP: May play a role in eye development. Defects in MFRP are the cause of nanophthalmos 2 (NNO2). NNO2 is a rare autosomal recessive disorder of eye development characterized by extreme hyperopia and small functional eyes. Defects in MFRP are the cause of microphthalmia isolated type 5 (MCOP5). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present. MCOP5 is characterized by posterior microphthalmia, retinitis pigmentosa, foveoschisis and optic disc drusen.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 11q23
Cellular Component: apical plasma membrane; integral to membrane
Biological Process: embryonic development
Disease: Microphthalmia, Isolated 5; Nanophthalmos 2
Research Articles on MFRP
1. Among five single nucleotide polymorphism(SNP)s tested, only MFRP rs3814762 and heat shock protein (HSP)70 rs1043618 show nominal association with primary angle closure.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
