Product Name
Sideroflexin 4 (SFXN4), Polyclonal Antibody
Full Product Name
Sideroflexin 4 antibody
Product Synonym Names
Polyclonal Sideroflexin 4; Anti-Sideroflexin 4; SFXN4; Sideroflexin -4; Sideroflexin 4; BCRM1
Product Gene Name
anti-SFXN4 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Specificity
Sideroflexin 4 antibody was raised against the C terminal of SFXN4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFXN4 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.
Immunogen
Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SFXN4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SFXN4 antibody
Rabbit polyclonal Sideroflexin 4 antibody raised against the C terminal of SFXN4
Product Categories/Family for anti-SFXN4 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-SFXN4 antibody
Western Blot (WB)
Application Notes for anti-SFXN4 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-SFXN4 antibody
Sideroflexin 4 antibody (MBS5301071) used at 1 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for SFXN4. It may not necessarily be applicable to this product.
NCBI Accession #
NP_998814.1
[Other Products]
NCBI GenBank Nucleotide #
NM_213649.1
[Other Products]
UniProt Secondary Accession #
Q6WSU4; Q86TD9[Other Products]
UniProt Related Accession #
Q6P4A7[Other Products]
Molecular Weight
38 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
sideroflexin-4
NCBI Official Synonym Full Names
sideroflexin 4
NCBI Official Symbol
SFXN4??[Similar Products]
NCBI Official Synonym Symbols
BCRM1; COXPD18
??[Similar Products]
NCBI Protein Information
sideroflexin-4
UniProt Protein Name
Sideroflexin-4
UniProt Synonym Protein Names
Breast cancer resistance marker 1
Protein Family
Sideroflexin
UniProt Gene Name
SFXN4??[Similar Products]
UniProt Synonym Gene Names
BCRM1??[Similar Products]
UniProt Entry Name
SFXN4_HUMAN
NCBI Summary for SFXN4
This gene encodes a member of the sideroflexin family. The encoded protein is a transmembrane protein of the inner mitochondrial membrane, and is required for mitochondrial respiratory homeostasis and erythropoiesis. Mutations in this gene are associated with mitochondriopathy and macrocytic anemia. Alternatively spliced transcript variants have been found in this gene. [provided by RefSeq, Jan 2014]
UniProt Comments for SFXN4
SFXN4: Potential iron transporter. Belongs to the sideroflexin family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 10q26.11
Cellular Component: intracellular membrane-bound organelle; mitochondrial inner membrane; integral to membrane
Molecular Function: ion transmembrane transporter activity
Biological Process: iron ion homeostasis
Disease: Combined Oxidative Phosphorylation Deficiency 18
Research Articles on SFXN4
1. Our findings establish mutations in SFXN4 as a cause of mitochondriopathy and macrocytic anemia.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
