Full Product Name
AICDA Antibody N-terminal region
Product Gene Name
anti-AICDA antibody
[Similar Products]
Product Synonym Gene Name
AID; ARP2; CDA2; HIGM2;[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Immunogen Sequence
Synthetic peptide located within the following region: VKRRDSATSF SLDFGYLRNK NGCHVELLFL RYISDWDLDP GRCYRVTWFT
3D Structure
ModBase 3D Structure for Q9GZX7
Species Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Other Notes
Small volumes of anti-AICDA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-AICDA antibody
activation-induced cytidine deaminase
Target Description: This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).
Product Categories/Family for anti-AICDA antibody
Antibody Samples;
Immunohistochemistry (IHC) of anti-AICDA antibody
Immunohistochemistry with Formalin-Fixed, Paraffin-Embedded (FFPE) human tonsil tissue at an antibody concentration of 10 ug/ml using anti-AICDA Antibody

NCBI/Uniprot data below describe general gene information for AICDA. It may not necessarily be applicable to this product.
NCBI Accession #
NP_065712
[Other Products]
NCBI GenBank Nucleotide #
NM_020661
[Other Products]
UniProt Primary Accession #
Q9GZX7
[Other Products]
UniProt Related Accession #
Q9GZX7[Other Products]
NCBI Official Full Name
single-stranded DNA cytosine deaminase isoform 1
NCBI Official Synonym Full Names
activation induced cytidine deaminase
NCBI Official Symbol
AICDA??[Similar Products]
NCBI Official Synonym Symbols
AID; ARP2; CDA2; HIGM2; HEL-S-284
??[Similar Products]
NCBI Protein Information
single-stranded DNA cytosine deaminase
UniProt Protein Name
Single-stranded DNA cytosine deaminase
UniProt Synonym Protein Names
Activation-induced cytidine deaminase; Cytidine aminohydrolase
Protein Family
Single-stranded DNA cytosine deaminase
UniProt Gene Name
AICDA??[Similar Products]
UniProt Synonym Gene Names
AID??[Similar Products]
UniProt Entry Name
AICDA_HUMAN
NCBI Summary for AICDA
This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2). [provided by RefSeq, Feb 2009]
UniProt Comments for AICDA
AID: Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation, gene conversion, and class- switch recombination in B-lymphocytes. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. Strongly expressed in lymph nodes and tonsils. Belongs to the cytidine and deoxycytidylate deaminase family.
Protein type: EC 3.5.4.38; Hydrolase
Chromosomal Location of Human Ortholog: 12p13
Cellular Component: cytoplasm; exosome (RNase complex); nucleus
Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; cytidine deaminase activity
Biological Process: somatic diversification of immunoglobulins; B cell differentiation; somatic hypermutation of immunoglobulin genes; isotype switching; cytidine deamination; mRNA processing
Disease: Immunodeficiency With Hyper-igm, Type 2
Research Articles on AICDA
1. AICDA targets SUV4-20-mediated histone H4K20 trimethylation to class-switch recombination sites.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.