Product Name
3-ketoacyl-CoA thiolase (THIM), Recombinant Protein
Popular Item
Full Product Name
Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial
Product Synonym Names
Acetyl-CoA acyltrans ferase; Beta-ketothiolase, Mitochondrial 3-oxoacyl-CoA thiolase; T1
Product Gene Name
THIM recombinant protein
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Sequence Positions
Full Length, 17-397aa
3D Structure
ModBase 3D Structure for P42765
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Tag Info
N-terminal 6xHis-tagged
Target Sequence
FGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRL
CGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAE
NLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKK
DGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDL
VEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAV
IIQSTA
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months
at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Other Notes
Small volumes of THIM recombinant protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
THIM recombinant protein
Abolishes BNIP3-mediated apoptosis and mitochondrial damage.
NCBI/Uniprot data below describe general gene information for THIM. It may not necessarily be applicable to this product.
NCBI Accession #
NP_006102.2
[Other Products]
NCBI GenBank Nucleotide #
NP_006102.2
[Other Products]
UniProt Primary Accession #
P42765
[Other Products]
UniProt Secondary Accession #
Q9BUT6[Other Products]
UniProt Related Accession #
P42765[Other Products]
NCBI Official Full Name
3-ketoacyl-CoA thiolase, mitochondrial
NCBI Official Synonym Full Names
acetyl-CoA acyltransferase 2
NCBI Official Symbol
ACAA2??[Similar Products]
NCBI Official Synonym Symbols
DSAEC
??[Similar Products]
NCBI Protein Information
3-ketoacyl-CoA thiolase, mitochondrial
UniProt Protein Name
3-ketoacyl-CoA thiolase, mitochondrial
UniProt Synonym Protein Names
Acetyl-CoA acyltransferase; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1
Protein Family
3-ketoacyl-CoA thiolase
UniProt Gene Name
ACAA2??[Similar Products]
NCBI Summary for THIM
The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
UniProt Comments for THIM
ACAA2: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. Belongs to the thiolase family.
Protein type: Amino Acid Metabolism - valine, leucine and isoleucine degradation; EC 2.3.1.16; Lipid Metabolism - fatty acid; Lipid Metabolism - fatty acid elongation in mitochondria; Transferase
Chromosomal Location of Human Ortholog: 18q21.1
Cellular Component: mitochondrial matrix; mitochondrion
Molecular Function: acetyl-CoA C-acyltransferase activity; protein binding; RNA binding
Biological Process: fatty acid beta-oxidation
Research Articles on THIM
1. Observational study of gene-disease association. (HuGE Navigator)
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.