Product Name
ATP10A, Polyclonal Antibody
Popular Item
Full Product Name
ATP10A Polyclonal Antibody
Product Synonym Names
ATP10A; ATP10C; ATPVA; ATPVC; probable phospholipid-transporting ATPase VA
Product Gene Name
anti-ATP10A antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for O60312
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.09 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 440-690 of human ATP10A (NP_077816.1).
Immunogen Sequence
RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
Positive Samples
A-549, U-251MG, DU-145, OVCAR3, HT-29, A-431
Cellular Location
Cell Membrane, Endoplasmic Reticulum Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-ATP10A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ATP10A antibody
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'.
Applications Tested/Suitable for anti-ATP10A antibody
Western Blot (WB)
Application Notes for anti-ATP10A antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-ATP10A antibody
Western blot-ATP10A Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for ATP10A. It may not necessarily be applicable to this product.
NCBI Accession #
NP_077816.1
[Other Products]
NCBI GenBank Nucleotide #
NP_077816.1
[Other Products]
UniProt Primary Accession #
O60312
[Other Products]
UniProt Related Accession #
O60312[Other Products]
Molecular Weight
Calculated: 17kDa; 167kDa
Observed: 170kDa
NCBI Official Full Name
probable phospholipid-transporting ATPase VA
NCBI Official Synonym Full Names
ATPase phospholipid transporting 10A (putative)
NCBI Official Symbol
ATP10A??[Similar Products]
NCBI Official Synonym Symbols
ATPVA; ATPVC; ATP10C
??[Similar Products]
NCBI Protein Information
probable phospholipid-transporting ATPase VA
UniProt Protein Name
Probable phospholipid-transporting ATPase VA
UniProt Synonym Protein Names
ATPase class V type 10A; Aminophospholipid translocase VA; P4-ATPase flippase complex alpha subunit ATP10A
Protein Family
Probable phospholipid-transporting ATPase
UniProt Gene Name
ATP10A??[Similar Products]
UniProt Synonym Gene Names
ATP10C; ATPVA; ATPVC; KIAA0566??[Similar Products]
UniProt Entry Name
AT10A_HUMAN
NCBI Summary for ATP10A
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'. [provided by RefSeq, Jul 2008]
Research Articles on ATP10A
1. results suggest that enhanced PC flipping activity due to exogenous ATP10A expression alters the lipid composition at the plasma membrane
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.