Full Product Name
Anti-LIFR Antibody
Product Synonym Names
Leukemia inhibitory factor receptor; CD118; CD118 antigen; FLJ98106; FLJ99923; Leukemia inhibitory factor receptor alpha; Leukemia inhibitory factor receptor; LIF R; LIF receptor; LIF-R; Lifr; LIFR_HUMAN; SJS2; STWS; SWS; leukemia inhibitory factor receptor alpha
Product Gene Name
anti-LIFR antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P42702
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-LIFR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-LIFR antibody
Description: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
Background: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the ***** and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
Applications Tested/Suitable for anti-LIFR antibody
Western Blot (WB)
Application Notes for anti-LIFR antibody
Western Blot Concentration: 0.1-0.5ug/ml
Western Blot (WB) of anti-LIFR antibody
Anti- LIFR Picoband antibody, MBS177717, Western blotting
All lanes: Anti LIFR (MBS177717) at 0.5ug/ml
Lane 1: SW620 Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 190KD
Observed bind size: 190KD

NCBI/Uniprot data below describe general gene information for LIFR. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001121143.1
[Other Products]
NCBI GenBank Nucleotide #
NM_001127671.1
[Other Products]
UniProt Primary Accession #
P42702
[Other Products]
UniProt Secondary Accession #
Q6LCD9[Other Products]
UniProt Related Accession #
P42702[Other Products]
NCBI Official Full Name
leukemia inhibitory factor receptor
NCBI Official Synonym Full Names
leukemia inhibitory factor receptor alpha
NCBI Official Symbol
LIFR??[Similar Products]
NCBI Official Synonym Symbols
SWS; SJS2; STWS; CD118; LIF-R
??[Similar Products]
NCBI Protein Information
leukemia inhibitory factor receptor
UniProt Protein Name
Leukemia inhibitory factor receptor
UniProt Synonym Protein Names
CD_antigen: CD118
Protein Family
Leukemia inhibitory factor receptor
UniProt Gene Name
LIFR??[Similar Products]
UniProt Synonym Gene Names
LIF receptor; LIF-R??[Similar Products]
UniProt Entry Name
LIFR_HUMAN
NCBI Summary for LIFR
This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the ***** and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
UniProt Comments for LIFR
LIFR: Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the
biological activity of LIF by blocking its binding to receptors on target cells. Defects in LIFR are the cause of Stueve-Wiedemann syndrome (SWS); also knowns as Schwartz-Jampel syndrome type 2 (SJS2). SWS is a severe autosomal recessive condition and belongs to the group of the bent-bone dysplasias. SWS is characterized by bowing of the lower limbs, with internal cortical thickening, wide metaphyses with abnormal trabecular pattern, and camptodactyly. Additional features include feeding and swallowing difficulties, as well as respiratory distress and hyperthermic episodes, which cause death in the first months of life. The rare survivors develop progressive scoliosis, spontaneous fractures, bowing of the lower limbs, with prominent joints and dysautonomia symptoms, including temperature instability, absent corneal and patellar reflexes, and smooth tongue. A chromosomal aberration involving LIFR is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(5;8)(p13;q12) with PLAG1. Belongs to the type I cytokine receptor family. Type 2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Receptor, cytokine
Chromosomal Location of Human Ortholog: 5p13-p12
Cellular Component: integral to plasma membrane; plasma membrane; receptor complex
Molecular Function: ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity; oncostatin-M receptor activity; protein heterodimerization activity
Biological Process: cell surface receptor linked signal transduction; cytokine and chemokine mediated signaling pathway; leukemia inhibitory factor signaling pathway; neurite morphogenesis; organ regeneration; positive regulation of cell proliferation; response to cytokine stimulus; response to organic cyclic substance
Disease: Stuve-wiedemann Syndrome
Product References and Citations for anti-LIFR antibody
1. "Entrez Gene: LIFR leukemia inhibitory factor receptor alpha". 2. Lass A, Weiser W, Munafo A, Loumaye E (2002). "Leukemia inhibitory factor in human reproduction". Fertil. Steril. 76 (6): 1091-6. 3. Tomida M (2003). "Structural and functional studies on the leukemia inhibitory factor receptor (LIF-R): gene and soluble form of LIF-R, and cytoplasmic domain of LIF-R required for differentiation and growth arrest of myeloid leukemic cells.". Leuk. Lymphoma 37 (5-6): 517-25.
Research Articles on LIFR
1. Stuve-Wiedemann syndrome patients with (p.Arg692X) LIFR mutation may develop central adrenal insufficiency due to impaired LIF/LIFR signalling. LIF/LIFR system plays a role in human HPA axis regulation.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.