Product Name
Bola2, Polyclonal Antibody
Popular Item
Full Product Name
Bola2 antibody - N-terminal region
Product Gene Name
anti-BOLA2 antibody
[Similar Products]
Product Synonym Gene Name
1110025L05Rik; BolA-2[Similar Products]
Antibody/Peptide Pairs
Bola2 peptide (MBS3228605) is used for blocking the activity of Bola2 antibody (MBS3203638)
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q8BGS2
Species Reactivity
Tested: Mouse; Predicted: Cow, Goat, Human, Mouse, Rabbit, Rat
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (lot specific)
Protein Size (# AA)
86 amino acids
Peptide Sequence
Synthetic peptide located within the following region: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL
Protein Interactions
Eed;
Blocking Peptide
For anti-Bola2 (MBS3203638) antibody is Catalog # MBS3228605
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bola2
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Goat: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Replacement Item
This antibody may replace item sc-141724 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Other Notes
Small volumes of anti-BOLA2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-BOLA2 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-BOLA2 antibody
Polyclonal; Transcription Factor;
Applications Tested/Suitable for anti-BOLA2 antibody
Western Blot (WB)
Western Blot (WB) of anti-BOLA2 antibody
WB Suggested Anti-Bola2 Antibody Titration: 0.2-1 ug/ml
Positive Control: SP2/0 cell lysate
NCBI/Uniprot data below describe general gene information for BOLA2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_780312
[Other Products]
NCBI GenBank Nucleotide #
NM_175103
[Other Products]
UniProt Primary Accession #
Q8BGS2
[Other Products]
UniProt Related Accession #
Q8BGS2[Other Products]
NCBI Official Full Name
bolA-like protein 2
NCBI Official Synonym Full Names
bolA-like 2 (E. coli)
NCBI Official Symbol
Bola2??[Similar Products]
NCBI Official Synonym Symbols
BolA-2; 1110025L05Rik
??[Similar Products]
NCBI Protein Information
bolA-like protein 2
UniProt Protein Name
BolA-like protein 2
Protein Family
BolA-like protein
UniProt Gene Name
Bola2??[Similar Products]
UniProt Entry Name
BOLA2_MOUSE
Research Articles on BOLA2
1. NMR structure of BolA2 [BolA2]
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
