Full Product Name
PCSK1 antibody
Product Synonym Names
Polyclonal PCSK1; Anti-PCSK1; PCSK-1; NEC1; PCSK 1; SPC3; PCSK1; Proprotein Convertase Subtilisin/Kexin Type 1; PC1; PC3
Product Gene Name
anti-PCSK1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Specificity
PCSK1 antibody was raised against the middle region of PCSK1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCSK1 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.
Immunogen
PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-PCSK1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-PCSK1 antibody
Rabbit polyclonal PCSK1 antibody raised against the middle region of PCSK1
Product Categories/Family for anti-PCSK1 antibody
Signal Transduction; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-PCSK1 antibody
Western Blot (WB)
Application Notes for anti-PCSK1 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-PCSK1 antibody
PCSK1 antibody (MBS839380) used at 1 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for PCSK1. It may not necessarily be applicable to this product.
NCBI Accession #
AKI72065.1
[Other Products]
UniProt Secondary Accession #
P78478; Q92532; B7Z8T7; E9PHA1[Other Products]
UniProt Related Accession #
P29120[Other Products]
Molecular Weight
71 kDa (MW of target protein)
NCBI Official Full Name
PCSK1, partial
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 1
NCBI Official Symbol
PCSK1??[Similar Products]
NCBI Official Synonym Symbols
PC1; PC3; NEC1; SPC3; BMIQ12
??[Similar Products]
NCBI Protein Information
neuroendocrine convertase 1
UniProt Protein Name
Neuroendocrine convertase 1
UniProt Synonym Protein Names
Prohormone convertase 1; Proprotein convertase 1; PC1
Protein Family
Neuroendocrine convertase
UniProt Gene Name
PCSK1??[Similar Products]
UniProt Synonym Gene Names
NEC1; NEC 1; PC1??[Similar Products]
UniProt Entry Name
NEC1_HUMAN
NCBI Summary for PCSK1
This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to subcellular compartments where a second autocatalytic even takes place and the catalytic activity is acquired. The protease is packaged into and activated in dense core secretory granules and expressed in the neuroendocrine system and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. It functions in the proteolytic activation of polypeptide hormones and neuropeptides precursors. Mutations in this gene have been associated with susceptibility to obesity and proprotein convertase 1/3 deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene [provided by RefSeq, Jan 2014]
UniProt Comments for PCSK1
PCSK1: Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin. Belongs to the peptidase S8 family. Furin subfamily.
Protein type: EC 3.4.21.93; Protease
Chromosomal Location of Human Ortholog: 5q15-q21
Cellular Component: Golgi apparatus; extracellular space; transport vesicle
Molecular Function: serine-type endopeptidase activity
Biological Process: cellular protein metabolic process; cell-cell signaling; metabolic process; peptide hormone processing; proteolysis; regulation of insulin secretion; peptide biosynthetic process
Disease: Proprotein Convertase 1/3 Deficiency; Body Mass Index Quantitative Trait Locus 12
Research Articles on PCSK1
1. Epistases between single nucleotide polymorphisms within proprotein convertase subtilisin/kexin type 1(PCSK1) and dopamine beta-hydroxylase(DBH) genes are significantly associated with susceptibility or resistance to premature ovarian failure
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.